PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00011_0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 925aa    MW: 97062.9 Da    PI: 6.909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00011_0100genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-153983146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r +WT+eEde l d v ++G g W++ a+ ++ gRt kqc++rw++
    kfl00011_0100 39 RPSWTQEEDEVLTDFVGKHGLGEWAAAAQVLP-GRTKKQCRNRWYN 83
                     679*****************************.************9 PP

2Myb_DNA-binding45.51.7e-1493133345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +WT+eE+ +l ++++q+G + W+tIa++m+   t+ ++k++w 
    kfl00011_0100  93 PWTKEEEAQLEQLHRQYGDK-WTTIAKHMP-DSTRSEVKNHWS 133
                      7*****************99.*********.778888*****5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.7493489IPR017930Myb domain
SuperFamilySSF466894.77E-2736132IPR009057Homeodomain-like
SMARTSM007175.4E-133887IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-173883IPR009057Homeodomain-like
PfamPF002491.2E-133984IPR001005SANT/Myb domain
CDDcd001675.85E-134183No hitNo description
Gene3DG3DSA:1.10.10.608.1E-1484134IPR009057Homeodomain-like
SMARTSM007176.7E-1290138IPR001005SANT/Myb domain
PROSITE profilePS5129414.41290140IPR017930Myb domain
PfamPF002491.4E-1293132IPR001005SANT/Myb domain
CDDcd001671.40E-1193132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 925 aa     Download sequence    Send to blast
MAAEGVTVSE LTGNAGEASQ YSQQGGGGKA ARRSPPAKRP SWTQEEDEVL TDFVGKHGLG  60
EWAAAAQVLP GRTKKQCRNR WYNALVSASK QAPWTKEEEA QLEQLHRQYG DKWTTIAKHM  120
PDSTRSEVKN HWSRMNPGKR DASPPAASLL RQYGLEIDGE RIVSIAPEFR GGSSEPTDGT  180
SPTTSEGGHK PGTLAGERPS RRLLPGSTTI LRGLGEKRVD SYGSLGGDRS SNLGANLGAD  240
VISPRGVESA GLAQQGTSAS PVPAFLAADV TLPSKRFPLD PLPRLGGRQL GPKSPPKTAS  300
ENSPRSSATA GSQNASSFEE SLSAGDEMGG SGANRGSAER PEGSTFDWVK EWVALSQKHG  360
TAGRETRAGG VSRMRGGPLT TEELSNNPLA SFSESPGLAG LGQEGPVGGI LGAFQLDFSG  420
GQAARCGGLP SHSRGISPNP SEHQTAFSDP IETVPLGRSG LFAPPLFRRT SVPAPRAHIA  480
PSLRRYASID LPCVASSVEE SPFPGLGAFN LSDLTISGEA RKRKPQSWGG GSGDEKRFRS  540
PKGANRTESF KGAESFEGAD AHVGAGPEIQ RPLAETLEAM REMYGRDLRG HIAWGRETEE  600
SVHTPGAKSK FGFAGGNQFS LGQGFASPGF AQSPGGRAFE SYNSARLSPG LGAGGHNRAE  660
KGDAKMPRGG NPSPPRGGGN SSDYATAKLT TLVTEHLNVL LEAQALQLEK AGVDQPSEMS  720
PEDLRQLHRA HLQMKAAVHF LSTLTGDHPP GPGTEGNVLR KGSPAEPHHS RSYSDCSPGG  780
ASIAQGTRHV AQREPHVGGQ FGAEIGLEVG DGRDPLRGAS WDGEPVERSD GGGVFKGRFR  840
GEGWGPLDVD QLEAAAPPHS RGHNGAQGMD WQLDTSAPAV GEGSEAPQAR ALEEVTATVY  900
DPSSVAGCQL PSWSTWGHNF SEASP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-213413322121MYB TRANSFORMING PROTEIN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-25myb domain protein 98